1.83 Rating by ClearWebStats
This website has a #1,178,221 rank in global traffic. It has a .be as an domain extension. This website has a Google PageRank of 1 out of 10. This domain is estimated value of $ 720.00 and has a daily earning of $ 3.00. While no active threats were reported recently by users, jpccollection.be is SAFE to browse.
Get Custom Widget

Traffic Report of Jpccollection

Daily Unique Visitors: 408
Daily Pageviews: 816

Estimated Valuation

Income Per Day: $ 3.00
Estimated Worth: $ 720.00

Search Engine Indexes

Google Indexed Pages: Not Applicable
Yahoo Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable
Alexa BackLinks: 18

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Privacy: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Google Pagerank: View jpccollection.be Pagerank
Alexa Rank: 1,178,221
Domain Authority: Not Applicable
Google Pagerank
PR 1 out of 10
PageSpeed Score
54
Siteadvisor Rating
View jpccollection.be site advisor rating Not Applicable

Where is jpccollection.be server located?

Hosted IP Address:

46.30.212.120 View other site hosted with jpccollection.be

Hosted Country:

jpccollection.be hosted country DK jpccollection.be hosted country

Location Latitude:

55.6759

Location Longitude:

12.5655

Social Engagement

Facebook Shares: Not Applicable
Facebook Likes: Not Applicable
Facebook Comments: Not Applicable
Twitter Count (Tweets): Not Applicable
Linkedin Shares: Not Applicable
Delicious Shares: Not Applicable

Page Resources Breakdown

View jpccollection.be HTML resources

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: Not Applicable H2 Headings: Not Applicable
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 39
Google Adsense: Not Applicable Google Analytics: UA-57494536-1

Websites Hosted on Same IP (i.e. 46.30.212.120)

LISTENABLE RECORDS ..//headquarter\..

jpccollection.be favicon - listenable.net

Listenable records

View jpccollection.be Pagerank   jpccollection.be alexa rank 1,842,905   jpccollection.be website value $ 480.00

Untitled Document

jpccollection.be favicon - philippemalouin.com

View jpccollection.be Pagerank   jpccollection.be alexa rank 2,753,607   jpccollection.be website value $ 240.00

warkii.com

jpccollection.be favicon - warkii.com

View jpccollection.be Pagerank   jpccollection.be alexa rank 1,200,825   jpccollection.be website value $ 480.00

QUEER JIHAD

jpccollection.be favicon - queerjihad.dk

View jpccollection.be Pagerank   jpccollection.be alexa rank Not Applicable   jpccollection.be website value $ 8.95

Disco-Disco.com - Where DISCO Acts and Music come alive!

jpccollection.be favicon - disco-disco.com

Disco-Disco.com... Where DISCO acts and music come alive!!! Artists, DJs, interviews, sound clips, labels, info and more.

View jpccollection.be Pagerank   jpccollection.be alexa rank 1,674,548   jpccollection.be website value $ 480.00

HTTP Header Analysis

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: Apache
Last-Modified: Thu, 22 Jan 2015 23:01:02 GMT
ETag: "8597a8a7-de33-50d45a56ced8d"
Vary: Accept-Encoding
Content-Encoding: gzip
Content-Type: text/html
Content-Length: 10482
Accept-Ranges: bytes
Date: Sat, 24 Jan 2015 00:49:33 GMT
X-Varnish: 184712763
Age: 0
Via: 1.1 varnish
Connection: keep-alive

Domain Information for jpccollection.be

Domain Registrar: DNS Belgium jpccollection.be registrar info

Domain Nameserver Information

Host IP Address Country
ns01.one.com jpccollection.be name server information 195.206.121.10 jpccollection.be server is located in Denmark Denmark
ns02.one.com jpccollection.be name server information 185.10.11.10 jpccollection.be server is located in Denmark Denmark
www.dns.be jpccollection.be name server information 149.126.56.5 jpccollection.be server is located in Belgium Belgium

DNS Record Analysis

Host Type TTL Extra
jpccollection.be A 3599 IP:46.30.212.120
jpccollection.be NS 14399 Target:ns02.one.com
jpccollection.be NS 14399 Target:ns01.one.com
jpccollection.be SOA 14399 MNAME:ns01.one.com
RNAME:hostmaster.one.com
Serial:2015011202
Refresh:14400
Retry:3600
Expire:1209600
jpccollection.be MX 3599 Priority:10
Target:mxcluster2.one.com
jpccollection.be MX 3599 Priority:10
Target:mxcluster1.one.com

Similarly Ranked Websites to Jpccollection

.:: SRI SUBRAHMANYASWAMY DEVALAYAM SKANDAGIRI ::.

jpccollection.be favicon - srisubrahmanyaswamydevalayamskandagiri.org

View jpccollection.be Pagerank   Alexa rank for jpccollection.be 1,178,223   website value of jpccollection.be $ 720.00

Error 406 - Not Acceptable

jpccollection.be favicon - redmondsgrill.com

View jpccollection.be Pagerank   Alexa rank for jpccollection.be 1,178,225   website value of jpccollection.be $ 720.00


IlTuopsicologo - Psicologia, Psicologo e Psicoterapeuta online

jpccollection.be favicon - iltuopsicologo.it

Sito di psicologia, dai contenuti innovativi, con utili indicazioni sui vari disagi psichici e relative terapie ed autoterapie. Consulenze online gratuite. Presenti diverse sezioni tematiche.

View jpccollection.be Pagerank   Alexa rank for jpccollection.be 1,178,226   website value of jpccollection.be $ 720.00

Home | Malibu Boats Australia

jpccollection.be favicon - malibuboats.com.au

View jpccollection.be Pagerank   Alexa rank for jpccollection.be 1,178,229   website value of jpccollection.be $ 720.00