Web stats for Jpccollection - jpccollection.be
1.83 Rating by ClearWebStats
This website has a #1,178,221 rank in global traffic. It has a .be as an domain extension. This website has a Google PageRank of 1 out of 10. This domain is estimated value of $ 720.00 and has a daily earning of $ 3.00. While no active threats were reported recently by users, jpccollection.be is SAFE to browse.
Traffic Report of Jpccollection
Daily Unique Visitors: | 408 |
Daily Pageviews: | 816 |
Estimated Valuation
Income Per Day: | $ 3.00 |
Estimated Worth: | $ 720.00 |
Search Engine Indexes
Google Indexed Pages: | Not Applicable |
Yahoo Indexed Pages: | Not Applicable |
Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
Google Backlinks: | Not Applicable |
Bing Backlinks: | Not Applicable |
Alexa BackLinks: | 18 |
Safety Information
Google Safe Browsing: | No Risk Issues |
Siteadvisor Rating: | Not Applicable |
WOT Trustworthiness: | Not Applicable |
WOT Privacy: | Not Applicable |
WOT Child Safety: | Not Applicable |
Website Ranks & Scores
Google Pagerank
PR 1 out of 10
PageSpeed Score
54
Siteadvisor Rating
Not Applicable
Where is jpccollection.be server located?
Social Engagement
Facebook Shares: | Not Applicable |
Facebook Likes: | Not Applicable |
Facebook Comments: | Not Applicable |
Twitter Count (Tweets): | Not Applicable |
Linkedin Shares: | Not Applicable |
Delicious Shares: | Not Applicable |
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
H1 Headings: | Not Applicable | H2 Headings: | Not Applicable |
H3 Headings: | Not Applicable | H4 Headings: | Not Applicable |
H5 Headings: | Not Applicable | H6 Headings: | Not Applicable |
Total IFRAMEs: | Not Applicable | Total Images: | 39 |
Google Adsense: | Not Applicable | Google Analytics: | UA-57494536-1 |
Websites Hosted on Same IP (i.e. 46.30.212.120)
Disco-Disco.com - Where DISCO Acts and Music come alive!
- disco-disco.com
Disco-Disco.com... Where DISCO acts and music come alive!!! Artists, DJs, interviews, sound clips, labels, info and more.
HTTP Header Analysis
Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: Apache
Last-Modified: Thu, 22 Jan 2015 23:01:02 GMT
ETag: "8597a8a7-de33-50d45a56ced8d"
Vary: Accept-Encoding
Content-Encoding: gzip
Content-Type: text/html
Content-Length: 10482
Accept-Ranges: bytes
Date: Sat, 24 Jan 2015 00:49:33 GMT
X-Varnish: 184712763
Age: 0
Via: 1.1 varnish
Connection: keep-alive
Status-Code: 200
Status: 200 OK
Server: Apache
Last-Modified: Thu, 22 Jan 2015 23:01:02 GMT
ETag: "8597a8a7-de33-50d45a56ced8d"
Vary: Accept-Encoding
Content-Encoding: gzip
Content-Type: text/html
Content-Length: 10482
Accept-Ranges: bytes
Date: Sat, 24 Jan 2015 00:49:33 GMT
X-Varnish: 184712763
Age: 0
Via: 1.1 varnish
Connection: keep-alive
Domain Information for jpccollection.be
Domain Nameserver Information
DNS Record Analysis
Host | Type | TTL | Extra |
---|---|---|---|
jpccollection.be | A | 3599 |
IP:46.30.212.120 |
jpccollection.be | NS | 14399 |
Target:ns02.one.com |
jpccollection.be | NS | 14399 |
Target:ns01.one.com |
jpccollection.be | SOA | 14399 |
MNAME:ns01.one.com RNAME:hostmaster.one.com Serial:2015011202 Refresh:14400 Retry:3600 Expire:1209600 |
jpccollection.be | MX | 3599 |
Priority:10 Target:mxcluster2.one.com |
jpccollection.be | MX | 3599 |
Priority:10 Target:mxcluster1.one.com |
Similarly Ranked Websites to Jpccollection
.:: SRI SUBRAHMANYASWAMY DEVALAYAM SKANDAGIRI ::.
- srisubrahmanyaswamydevalayamskandagiri.org
IlTuopsicologo - Psicologia, Psicologo e Psicoterapeuta online
- iltuopsicologo.it
Sito di psicologia, dai contenuti innovativi, con utili indicazioni sui vari disagi psichici e relative terapie ed autoterapie. Consulenze online gratuite. Presenti diverse sezioni tematiche.